Lineage for d1gtra1 (1gtr A:339-547)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
barrel, closed; n=6, S=10; complex topologySuperfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) 
Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
automatically mapped to Pfam PF03950Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
duplication, consists of two barrel domains with the swapping of N-terminal strandsSpecies Escherichia coli [TaxId:562] [50721] (17 PDB entries) 
Domain d1gtra1: 1gtr A:339-547 [26939]
Other proteins in same PDB: d1gtra2
protein/RNA complex; complexed with atp
Details for d1gtra1
PDB Entry: 1gtr (more details), 2.5 Å
PDB Description: structural basis of anticodon loop recognition by glutaminyl-trna synthetase
PDB Compounds: (A:) glutaminyl-tRNA synthetaseSCOPe Domain Sequences for d1gtra1:
Sequence, based on SEQRES records: (download)
>d1gtra1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt
Sequence, based on observed residues (ATOM records): (download)
>d1gtra1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt
SCOPe Domain Coordinates for d1gtra1:
Click to download the PDB-style file with coordinates for d1gtra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtra1:
- d1gtra1 first appeared (with stable ids) in SCOP 1.55
- d1gtra1 appears in SCOPe 2.07
View in 3D
