Lineage for d1gtaa2 (1gta A:1-80)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) Protein Class alpha GST [81360] (8 species) 
Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
Uniprot P08515
Domain d1gtaa2: 1gta A:1-80 [33014]
Other proteins in same PDB: d1gtaa1
Details for d1gtaa2
PDB Entry: 1gta (more details), 2.4 Å
PDB Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
PDB Compounds: (A:) glutathione s-transferaseSCOPe Domain Sequences for d1gtaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtaa2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn
SCOPe Domain Coordinates for d1gtaa2:
Click to download the PDB-style file with coordinates for d1gtaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gtaa2:
- d1gtaa2 first appeared (with stable ids) in SCOP 1.55, called d1gta_2
- d1gtaa2 appears in SCOPe 2.06
- d1gtaa2 appears in the current release, SCOPe 2.08
View in 3D
