Lineage for d1gssa1 (1gss A:77-207)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326363Protein Class pi GST [81347] (4 species)
  7. 2326364Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)
  8. 2326511Domain d1gssa1: 1gss A:77-207 [17584]
    Other proteins in same PDB: d1gssa2, d1gssb2
    complexed with lee

Details for d1gssa1

PDB Entry: 1gss (more details), 2.8 Å

PDB Description: three-dimensional structure of class pi glutathione s-transferase from human placenta in complex with s-hexylglutathione at 2.8 angstroms resolution
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1gssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gssa1 a.45.1.1 (A:77-207) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOPe Domain Coordinates for d1gssa1:

Click to download the PDB-style file with coordinates for d1gssa1.
(The format of our PDB-style files is described here.)

Timeline for d1gssa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gssa2