Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Spore coat protein A, CotA, N- and C-terminal domain [418912] (2 species) |
Species Bacillus subtilis [TaxId:1423] [419334] (13 PDB entries) Uniprot P07788 |
Domain d1gska1: 1gsk A:2-182 [83314] Other proteins in same PDB: d1gska2 complexed with c1o, c2o, cu, gol |
PDB Entry: 1gsk (more details), 1.7 Å
SCOPe Domain Sequences for d1gska1:
Sequence, based on SEQRES records: (download)
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr l
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA, N- and C-terminal domain {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl
Timeline for d1gska1: