Lineage for d1gs6x1 (1gs6 X:1-159)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (7 families) 
contains copper-binding site
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) Protein Nitrite reductase, NIR [49551] (5 species)
consists of two domains of this foldSpecies Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
Uniprot O68601 25-360
Uniprot O68601 26-359
Uniprot O68601
Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
Domain d1gs6x1: 1gs6 X:1-159 [65529]
Details for d1gs6x1
PDB Entry: 1gs6 (more details), 2.2 Å
PDB Description: crystal structure of m144a mutant of alcaligenes xylosoxidans nitrite reductase
PDB Compounds: (X:) nitrite reductaseSCOP Domain Sequences for d1gs6x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gs6x1 b.6.1.3 (X:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapegmvpwhvvsgasgtlmvlprdglkdp
SCOP Domain Coordinates for d1gs6x1:
Click to download the PDB-style file with coordinates for d1gs6x1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gs6x1:
- d1gs6x1 first appeared in SCOP 1.59
- d1gs6x1 appears in SCOP 1.73
- d1gs6x1 appears in SCOPe 2.01
- d1gs6x1 appears in the current release, SCOPe 2.08
View in 3D
