| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
| Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins) Pfam PF00620 |
| Protein Cdc42GAP [48356] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48357] (2 PDB entries) |
| Domain d1grnb_: 1grn B: [19106] Other proteins in same PDB: d1grna_ complexed with af3, gdp, mg |
PDB Entry: 1grn (more details), 2.1 Å
SCOPe Domain Sequences for d1grnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grnb_ a.116.1.1 (B:) Cdc42GAP {Human (Homo sapiens) [TaxId: 9606]}
lpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqqk
ynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlqv
lqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainpi
ntftkflldhqgelfps
Timeline for d1grnb_: