Lineage for d1gqza2 (1gqz A:131-274)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546596Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2546597Protein Diaminopimelate epimerase [54508] (3 species)
  7. 2546607Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. 2546613Domain d1gqza2: 1gqz A:131-274 [83312]

Details for d1gqza2

PDB Entry: 1gqz (more details), 1.75 Å

PDB Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d1gqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqza2 d.21.1.1 (A:131-274) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
tankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgpllesherfpervn
agfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqvdlpggslmie
wngvghplymtgeathiydgfitl

SCOPe Domain Coordinates for d1gqza2:

Click to download the PDB-style file with coordinates for d1gqza2.
(The format of our PDB-style files is described here.)

Timeline for d1gqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqza1