Lineage for d1gqza1 (1gqz A:1-130)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. Protein Diaminopimelate epimerase [54508] (3 species)
  7. Species Haemophilus influenzae [TaxId:727] [54509] (6 PDB entries)
  8. Domain d1gqza1: 1gqz A:1-130 [83311]

Details for d1gqza1

PDB Entry: 1gqz (more details), 1.7500000000000002 Å

PDB Description: refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d1gqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqza1 d.21.1.1 (A:1-130) Diaminopimelate epimerase {Haemophilus influenzae [TaxId: 727]}
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkddnqirvnmge
piwepakipf

SCOPe Domain Coordinates for d1gqza1 are not available.

Timeline for d1gqza1:

Domains from same chain:
(mouse over for more information)
d1gqza2