Lineage for d1gqfa_ (1gqf A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.17: Caspase-like [52128] (1 superfamily)
3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the restSuperfamily c.17.1: Caspase-like [52129] (3 families) 
mature protein may be composed of two chains folded in a single domainFamily c.17.1.1: Caspase catalytic domain [52130] (8 proteins) 
Protein Caspase-7 [63961] (1 species) Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries)
Uniprot P55210 57-303
Domain d1gqfa_: 1gqf A: [65470]
complexed with so4
Details for d1gqfa_
PDB Entry: 1gqf (more details), 2.9 Å
PDB Description: crystal structure of human procaspase-7
SCOPe Domain Sequences for d1gqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqfa_ c.17.1.1 (A:) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
sikttrdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgf
dvivyndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahf
rgdrcktllekpklffiqaargtelddgiqadsgpindtdanprykipveadflfaystv
pgyyswrspgrgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekk
qipcvvsmltkelyfsqlehhhhhh
SCOPe Domain Coordinates for d1gqfa_:
Click to download the PDB-style file with coordinates for d1gqfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gqfa_:
- d1gqfa_ first appeared in SCOP 1.59
- d1gqfa_ appears in SCOPe 2.04
- d1gqfa_ is called d1gqfa1 in SCOPe 2.06
- d1gqfa_ appears in the current release, SCOPe 2.08, called d1gqfa1
View in 3D
