Lineage for d1gq3a1 (1gq3 A:1-150)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) 
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) 
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) 
Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
Uniprot P00479
Domain d1gq3a1: 1gq3 A:1-150 [76268]
complexed with ca; mutant
Details for d1gq3a1
PDB Entry: 1gq3 (more details), 2.01 Å
PDB Description: structure of the r105a mutant catalytic trimer of escherichia coli aspartate transcarbamoylase at 2.0-a resolution
PDB Compounds: (A:) aspartate carbamoyltransferaseSCOPe Domain Sequences for d1gq3a1:
Sequence, based on SEQRES records: (download)
>d1gq3a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmahpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg
Sequence, based on observed residues (ATOM records): (download)
>d1gq3a1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsgetladtisvistyvdaivmahpqegaarlatefsgnvpvlnag
hptqtlldlftiqetqg
SCOPe Domain Coordinates for d1gq3a1:
Click to download the PDB-style file with coordinates for d1gq3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gq3a1:
- d1gq3a1 first appeared in SCOP 1.63
- d1gq3a1 appears in SCOPe 2.05
- d1gq3a1 does not appear in SCOPe 2.07
 View in 3DDomains from other chains: (mouse over for more information) d1gq3b1, d1gq3b2, d1gq3c1, d1gq3c2 |
