Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (4 species) |
Species Thermotoga maritima [TaxId:2336] [69448] (9 PDB entries) |
Domain d1gpwd_: 1gpw D: [65463] Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_ complexed with po4 |
PDB Entry: 1gpw (more details), 2.4 Å
SCOPe Domain Sequences for d1gpwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpwd_ c.23.16.1 (D:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe ksskigrkllekviecslsrr
Timeline for d1gpwd_: