Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
Protein Anthocyanidin synthase [69346] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69347] (3 PDB entries) |
Domain d1gp6a_: 1gp6 A: [65441] complexed with dh2, fe2, mes, que, sin |
PDB Entry: 1gp6 (more details), 1.75 Å
SCOPe Domain Sequences for d1gp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gp6a_ b.82.2.1 (A:) Anthocyanidin synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeqeelv
Timeline for d1gp6a_: