Lineage for d1gp6a_ (1gp6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815434Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
    common fold is rather distorted
  6. 2815440Protein Anthocyanidin synthase [69346] (1 species)
  7. 2815441Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [69347] (3 PDB entries)
  8. 2815442Domain d1gp6a_: 1gp6 A: [65441]
    complexed with dh2, fe2, mes, que, sin

Details for d1gp6a_

PDB Entry: 1gp6 (more details), 1.75 Å

PDB Description: Anthocyanidin synthase from Arabidopsis thaliana complexed with trans-dihydroquercetin (with 30 min exposure to O2)
PDB Compounds: (A:) leucoanthocyanidin dioxygenase

SCOPe Domain Sequences for d1gp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gp6a_ b.82.2.1 (A:) Anthocyanidin synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vaverveslaksgiisipkeyirpkeelesindvfleekkedgpqvptidlkniesddek
irencieelkkasldwgvmhlinhgipadlmervkkageeffslsveekekyandqatgk
iqgygsklannasgqlewedyffhlaypeekrdlsiwpktpsdyieatseyakclrllat
kvfkalsvglglepdrlekevggleelllqmkinyypkcpqpelalgveahtdvsaltfi
lhnmvpglqlfyegkwvtakcvpdsivmhigdtleilsngkyksilhrglvnkekvrisw
avfceppkdkivlkplpemvsvespakfpprtfaqhiehklfgkeqeelv

SCOPe Domain Coordinates for d1gp6a_:

Click to download the PDB-style file with coordinates for d1gp6a_.
(The format of our PDB-style files is described here.)

Timeline for d1gp6a_: