Lineage for d1goja_ (1goj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2868783Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 2868784Protein Kinesin [52646] (7 species)
  7. 2868785Species Fungus (Neurospora crassa) [TaxId:5141] [69490] (1 PDB entry)
  8. 2868786Domain d1goja_: 1goj A: [65419]
    complexed with adp, mg

Details for d1goja_

PDB Entry: 1goj (more details), 2.3 Å

PDB Description: structure of a fast kinesin: implications for atpase mechanism and interactions with microtubules
PDB Compounds: (A:) kinesin heavy chain

SCOPe Domain Sequences for d1goja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goja_ c.37.1.9 (A:) Kinesin {Fungus (Neurospora crassa) [TaxId: 5141]}
sssansikvvarfrpqnrveiesggqpivtfqgpdtctvdskeaqgsftfdrvfdmsckq
sdifdfsikptvddilngyngtvfaygqtgagksytmmgtsiddpdgrgvipriveqift
silssaanieytvrvsymeiymerirdllapqndnlpvheeknrgvyvkglleiyvssvq
evyevmrrggnaravaatnmnqessrshsifvititqknvetgsaksgqlflvdlagsek
vgktgasgqtleeakkinkslsalgmvinaltdgksshvpyrdskltrilqeslggnsrt
tliincspssyndaetlstlrfgmraksiknkakvnaelspaelkqmlakaktq

SCOPe Domain Coordinates for d1goja_:

Click to download the PDB-style file with coordinates for d1goja_.
(The format of our PDB-style files is described here.)

Timeline for d1goja_: