Lineage for d1gofa3 (1gof A:151-537)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554690Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family) (S)
  5. 1554691Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)
  6. 1554692Protein Galactose oxidase, central domain [50967] (3 species)
    N-terminal domain is a jelly-roll sandwich
    C-terminal domain is Immunoglobulin-like
  7. 1554693Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
    Uniprot Q01745 42-680
  8. 1554694Domain d1gofa3: 1gof A:151-537 [27631]
    Other proteins in same PDB: d1gofa1, d1gofa2
    complexed with acy, cu, na

Details for d1gofa3

PDB Entry: 1gof (more details), 1.7 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1gofa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gofa3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

SCOPe Domain Coordinates for d1gofa3:

Click to download the PDB-style file with coordinates for d1gofa3.
(The format of our PDB-style files is described here.)

Timeline for d1gofa3: