Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
Protein GABA(A) receptor associated protein GABARAP [69658] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [69659] (6 PDB entries) |
Domain d1gnua_: 1gnu A: [65403] complexed with ni |
PDB Entry: 1gnu (more details), 1.75 Å
SCOPe Domain Sequences for d1gnua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnua_ d.15.1.3 (A:) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
Timeline for d1gnua_: