Lineage for d1gnka_ (1gnk A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.5: GlnB-like [54913] (6 families) 
form timeric structures with the orthogonally packed beta-sheetsFamily d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) 
Protein PII-homolog GlnK [54917] (2 species) Species Escherichia coli [TaxId:562] [54918] (3 PDB entries) 
Domain d1gnka_: 1gnk A: [39073]
complexed with so4
Details for d1gnka_
PDB Entry: 1gnk (more details), 2 Å
PDB Description: glnk, a signal protein from e. coli
PDB Compounds: (A:) protein (glnk)SCOPe Domain Sequences for d1gnka_:
Sequence, based on SEQRES records: (download)
>d1gnka_ d.58.5.1 (A:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal
Sequence, based on observed residues (ATOM records): (download)
>d1gnka_ d.58.5.1 (A:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrvnflpkvkidvaiaddqldevi
divskaaytgkigdgkifvaelqrvirirtgeadeaal
SCOPe Domain Coordinates for d1gnka_:
Click to download the PDB-style file with coordinates for d1gnka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gnka_:
- d1gnka_ first appeared (with stable ids) in SCOP 1.55
- d1gnka_ appears in SCOPe 2.07
View in 3D
