Lineage for d1gngb_ (1gng B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [69824] (56 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. Domain d1gngb_: 1gng B: [76240]
    complexed with so4, trs

Details for d1gngb_

PDB Entry: 1gng (more details), 2.6 Å

PDB Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide
PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d1gngb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gngb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

SCOPe Domain Coordinates for d1gngb_ are not available.

Timeline for d1gngb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gnga_