Lineage for d1gnea2 (1gne A:1-79)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) 
Protein Class alpha GST [81360] (8 species) 
Species Schistosoma japonicum [TaxId:6182] [52878] (15 PDB entries)
Uniprot P08515
Domain d1gnea2: 1gne A:1-79 [33015]
Other proteins in same PDB: d1gnea1
complexed with gsh
Details for d1gnea2
PDB Entry: 1gne (more details), 2.5 Å
PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
PDB Compounds: (A:) glutathione s-transferaseSCOPe Domain Sequences for d1gnea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnea2 c.47.1.5 (A:1-79) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhn
SCOPe Domain Coordinates for d1gnea2:
Click to download the PDB-style file with coordinates for d1gnea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gnea2:
- d1gnea2 first appeared (with stable ids) in SCOP 1.55, called d1gne_2
- d1gnea2 appears in SCOPe 2.07
View in 3D
