Lineage for d1gnea1 (1gne A:80-232)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) Protein Class alpha GST [81349] (8 species) 
Species Schistosoma japonicum [TaxId:6182] [47633] (13 PDB entries)
Uniprot P08515
Domain d1gnea1: 1gne A:80-232 [17721]
Other proteins in same PDB: d1gnea2
fused with a gp41 epitope of HIV-1
complexed with gsh
Details for d1gnea1
PDB Entry: 1gne (more details), 2.5 Å
PDB Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
PDB Compounds: (A:) glutathione s-transferaseSCOPe Domain Sequences for d1gnea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnea1 a.45.1.1 (A:80-232) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhppksdlvprgsmeldkwa
SCOPe Domain Coordinates for d1gnea1:
Click to download the PDB-style file with coordinates for d1gnea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gnea1:
- d1gnea1 first appeared (with stable ids) in SCOP 1.55, called d1gne_1
- d1gnea1 appears in SCOPe 2.03
- d1gnea1 appears in SCOPe 2.05
- d1gnea1 appears in the current release, SCOPe 2.08
View in 3D
