Lineage for d1gmed_ (1gme D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773839Family b.15.1.1: HSP20 [49765] (2 proteins)
  6. 2773840Protein Small heat shock protein [49766] (2 species)
  7. 2773860Species Wheat (Triticum aestivum) [TaxId:4565] [69208] (3 PDB entries)
  8. 2773864Domain d1gmed_: 1gme D: [65308]

Details for d1gmed_

PDB Entry: 1gme (more details), 2.7 Å

PDB Description: crystal structure and assembly of an eukaryotic small heat shock protein
PDB Compounds: (D:) heat shock protein 16.9b

SCOPe Domain Sequences for d1gmed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmed_ b.15.1.1 (D:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]}
anarmdwketpeahvfkadlpgvkkeevkvevedgnvlvvsgertkekedkndkwhrver
ssgkfvrrfrlledakveevkaglengvltvtvpkaevkkpevkaiqisg

SCOPe Domain Coordinates for d1gmed_:

Click to download the PDB-style file with coordinates for d1gmed_.
(The format of our PDB-style files is described here.)

Timeline for d1gmed_: