SCOPe 2.03: Domain d1glfo1: 1glf O:2-253

Lineage for d1glfo1 (1glf O:2-253)

Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
duplication contains two domains of this fold
Family c.55.1.4: Glycerol kinase [53089] (1 protein)
Protein Glycerol kinase [53090] (2 species)
Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
Domain d1glfo1: 1glf O:2-253 [33509]
complexed with adp, gol, po4; mutant

Details for d1glfo1

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation

PDB Compounds: (O:) protein (glycerol kinase)

SCOPe Domain Sequences for d1glfo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfo1 c.55.1.4 (O:2-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisg
iagdqqaalfgq

SCOPe Domain Coordinates for d1glfo1:

Click to download the PDB-style file with coordinates for d1glfo1.
(The format of our PDB-style files is described here.)

Timeline for d1glfo1: