Lineage for d1gjwa1 (1gjw A:573-636)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808463Protein Maltosyltransferase [63835] (1 species)
  7. 808464Species Thermotoga maritima [TaxId:2336] [63836] (2 PDB entries)
  8. 808465Domain d1gjwa1: 1gjw A:573-636 [60582]
    Other proteins in same PDB: d1gjwa2
    complexed with glc, mal, po4

Details for d1gjwa1

PDB Entry: 1gjw (more details), 2.1 Å

PDB Description: thermotoga maritima maltosyltransferase complex with maltose
PDB Compounds: (A:) maltodextrin glycosyltransferase

SCOP Domain Sequences for d1gjwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjwa1 b.71.1.1 (A:573-636) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]}
gkfenlttkdlvmysyekngqkiviaanvgkepkeitggrvwngkwsdeekvvlkplefa
lvvq

SCOP Domain Coordinates for d1gjwa1:

Click to download the PDB-style file with coordinates for d1gjwa1.
(The format of our PDB-style files is described here.)

Timeline for d1gjwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjwa2