| Class b: All beta proteins [48724] (174 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Maltosyltransferase [63835] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [63836] (2 PDB entries) |
| Domain d1gjwa1: 1gjw A:573-636 [60582] Other proteins in same PDB: d1gjwa2 complexed with glc, mal, po4 |
PDB Entry: 1gjw (more details), 2.1 Å
SCOP Domain Sequences for d1gjwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjwa1 b.71.1.1 (A:573-636) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]}
gkfenlttkdlvmysyekngqkiviaanvgkepkeitggrvwngkwsdeekvvlkplefa
lvvq
Timeline for d1gjwa1: