Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (10 species) |
Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries) |
Domain d1gjna_: 1gjn A: [70191] complexed with hem, oh, so4 |
PDB Entry: 1gjn (more details), 1.35 Å
SCOPe Domain Sequences for d1gjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjna_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]} glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d1gjna_: