Lineage for d1gjia2 (1gji A:7-181)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2041189Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2041213Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. 2041214Species Chicken (Gallus gallus), C-rel [TaxId:9031] [74867] (1 PDB entry)
  8. 2041215Domain d1gjia2: 1gji A:7-181 [70188]
    Other proteins in same PDB: d1gjia1, d1gjib1
    protein/DNA complex

Details for d1gjia2

PDB Entry: 1gji (more details), 2.85 Å

PDB Description: Crystal structure of c-Rel bound to DNA
PDB Compounds: (A:) c-rel proto-oncogene protein

SCOPe Domain Sequences for d1gjia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjia2 b.2.5.3 (A:7-181) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]}
pyieifeqprqrgmrfrykcegrsagsipgehstdnnktfpsiqilnyfgkvkirttlvt
knepykphphdlvgkdcrdgyyeaefgperrvlsfqnlgiqcvkkkdlkesislriskki
npfnvpeeqlhnideydlnvvrlcfqaflpdehgnytlalpplisnpiydnrapn

SCOPe Domain Coordinates for d1gjia2:

Click to download the PDB-style file with coordinates for d1gjia2.
(The format of our PDB-style files is described here.)

Timeline for d1gjia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjia1