Lineage for d1gjia2 (1gji A:7-181)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) 
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
automatically mapped to Pfam PF00554
Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) 
Species Chicken (Gallus gallus), C-rel [TaxId:9031] [74867] (1 PDB entry) 
Domain d1gjia2: 1gji A:7-181 [70188]
Other proteins in same PDB: d1gjia1, d1gjib1
protein/DNA complex
Details for d1gjia2
PDB Entry: 1gji (more details), 2.85 Å
PDB Description: Crystal structure of c-Rel bound to DNA
PDB Compounds: (A:) c-rel proto-oncogene proteinSCOPe Domain Sequences for d1gjia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjia2 b.2.5.3 (A:7-181) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]}
pyieifeqprqrgmrfrykcegrsagsipgehstdnnktfpsiqilnyfgkvkirttlvt
knepykphphdlvgkdcrdgyyeaefgperrvlsfqnlgiqcvkkkdlkesislriskki
npfnvpeeqlhnideydlnvvrlcfqaflpdehgnytlalpplisnpiydnrapn
SCOPe Domain Coordinates for d1gjia2:
Click to download the PDB-style file with coordinates for d1gjia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gjia2:
- d1gjia2 first appeared in SCOP 1.61
- d1gjia2 appears in SCOPe 2.07
View in 3D
