![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species) mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component) |
![]() | Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries) |
![]() | Domain d1giqa1: 1giq A:3-209 [76224] complexed with nai |
PDB Entry: 1giq (more details), 1.8 Å
SCOPe Domain Sequences for d1giqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1giqa1 d.166.1.1 (A:3-209) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]} ierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfydy qiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfnel ketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlieqd ysikidkivriviegkqyikaeasivn
Timeline for d1giqa1: