Lineage for d1ghca_ (1ghc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693281Family a.4.5.13: Linker histone H1/H5 [46827] (4 proteins)
    automatically mapped to Pfam PF00538
  6. 2693288Protein Histone H1, globular domain [46830] (1 species)
  7. 2693289Species Chicken (Gallus gallus) [TaxId:9031] [46831] (1 PDB entry)
  8. 2693290Domain d1ghca_: 1ghc A: [16142]

Details for d1ghca_

PDB Entry: 1ghc (more details)

PDB Description: homo-and heteronuclear two-dimensional nmr studies of the globular domain of histone h1: full assignment, tertiary structure, and comparison with the globular domain of histone h5
PDB Compounds: (A:) gh1

SCOPe Domain Sequences for d1ghca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghca_ a.4.5.13 (A:) Histone H1, globular domain {Chicken (Gallus gallus) [TaxId: 9031]}
magpsvtelitkavsaskerkglslaalkkalaaggydveknnsriklglkslvskgtlv
qtkgtgasgsfrlsk

SCOPe Domain Coordinates for d1ghca_:

Click to download the PDB-style file with coordinates for d1ghca_.
(The format of our PDB-style files is described here.)

Timeline for d1ghca_: