Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Cdc4p [63543] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [63544] (1 PDB entry) |
Domain d1ggwa_: 1ggw A: [60490] |
PDB Entry: 1ggw (more details)
SCOPe Domain Sequences for d1ggwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} stddspykqafslfdrhgtgripktsigdllracgqnptlaeiteiestlpaevdmeqfl qvlnrpngfdmpgdpeefvkgfqvfdkdatgmigvgelryvltslgeklsneemdellkg vpvkdgmvnyhdfvqmilan
Timeline for d1ggwa_: