Lineage for d1ggga_ (1ggg A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
has additional insertions and/or extensions that are not grouped together
Protein Glutamine-binding protein [53879] (1 species) Species Escherichia coli [TaxId:562] [53880] (2 PDB entries) 
Domain d1ggga_: 1ggg A: [35817]
Details for d1ggga_
PDB Entry: 1ggg (more details), 2.3 Å
PDB Description: glutamine binding protein open ligand-free structure
PDB Compounds: (A:) glutamine binding proteinSCOPe Domain Sequences for d1ggga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggga_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]}
lvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvdl
alagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdya
kaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaqq
ygiafpkgsdelrdkvngalktlrengtyneiykkwfgte
SCOPe Domain Coordinates for d1ggga_:
Click to download the PDB-style file with coordinates for d1ggga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ggga_:
- d1ggga_ first appeared (with stable ids) in SCOP 1.55
- d1ggga_ appears in SCOPe 2.07
View in 3D
