Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) |
Protein Trp synthase alpha-subunit [51388] (5 species) |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [51390] (2 PDB entries) |
Domain d1geqa_: 1geq A: [28589] |
PDB Entry: 1geq (more details), 2 Å
SCOP Domain Sequences for d1geqa_:
Sequence, based on SEQRES records: (download)
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslygttgareeipktay dllrrakricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkk kveellgi
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} mfkdgslipyltagdpdkqstlnfllaldeyagaielgipfsdpiadgktiqeshyralk ngfklreafwivkefrrhsstpivlmtyynpiyragvrnflaeakasgvdgilvvdlpvf hakefteiareegiktvflaapntpderlkviddmttgfvylvslyeipktaydllrrak ricrnkvavgfgvskrehvvsllkegangvvvgsalvkiigekgreateflkkkveellg i
Timeline for d1geqa_: