Lineage for d1gena_ (1gen A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074482Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2074483Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2074484Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)
  6. 2074494Protein Gelatinase A (MMP-2), C-terminal domain [50927] (1 species)
  7. 2074495Species Human (Homo sapiens) [TaxId:9606] [50928] (4 PDB entries)
  8. 2074496Domain d1gena_: 1gen A: [27536]
    complexed with ca, cl, na, zn

Details for d1gena_

PDB Entry: 1gen (more details), 2.15 Å

PDB Description: c-terminal domain of gelatinase a
PDB Compounds: (A:) gelatinase a

SCOPe Domain Sequences for d1gena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lgpvtpeickqdivfdgiaqirgeifffkdrfiwrtvtprdkpmgpllvatfwpelpeki
davyeapqeekavffagneywiysastlergypkpltslglppdvqrvdaafnwsknkkt
yifagdkfwrynevkkkmdpgfpkliadawnaipdnldavvdlqggghsyffkgayylkl
enqslksvkfgsiksdwlgc

SCOPe Domain Coordinates for d1gena_:

Click to download the PDB-style file with coordinates for d1gena_.
(The format of our PDB-style files is described here.)

Timeline for d1gena_: