Lineage for d1gege_ (1geg E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842639Protein meso-2,3-butanediol dehydrogenase [51786] (1 species)
  7. 2842640Species Klebsiella pneumoniae [TaxId:573] [51787] (1 PDB entry)
  8. 2842645Domain d1gege_: 1geg E: [29892]
    complexed with bme, glc, mg, nad

Details for d1gege_

PDB Entry: 1geg (more details), 1.7 Å

PDB Description: cryatal structure analysis of meso-2,3-butanediol dehydrogenase
PDB Compounds: (E:) acetoin reductase

SCOPe Domain Sequences for d1gege_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gege_ c.2.1.2 (E:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}
mkkvalvtgagqgigkaialrlvkdgfavaiadyndatakavaseinqagghavavkvdv
sdrdqvfaaveqarktlggfdvivnnagvapstpiesitpeivdkvyninvkgviwgiqa
aveafkkeghggkiinacsqaghvgnpelavyssskfavrgltqtaardlaplgitvngy
cpgivktpmwaeidrqvseaagkplgygtaefakritlgrlsepedvaacvsylaspdsd
ymtgqsllidggmvfn

SCOPe Domain Coordinates for d1gege_:

Click to download the PDB-style file with coordinates for d1gege_.
(The format of our PDB-style files is described here.)

Timeline for d1gege_: