Lineage for d1ge8a1 (1ge8 A:2-117)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetrySuperfamily d.131.1: DNA clamp [55979] (3 families) 
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
duplication: consists of two domains of this foldProtein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) 
Species Pyrococcus furiosus [TaxId:2261] [55992] (5 PDB entries) 
Domain d1ge8a1: 1ge8 A:2-117 [41398]
Details for d1ge8a1
PDB Entry: 1ge8 (more details), 2.1 Å
PDB Description: proliferating cell nuclear antigen (pcna) homolog from pyrococcus furiosus
PDB Compounds: (A:) proliferation cell nuclear antigenSCOPe Domain Sequences for d1ge8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ge8a1 d.131.1.2 (A:2-117) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplid
SCOPe Domain Coordinates for d1ge8a1:
Click to download the PDB-style file with coordinates for d1ge8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ge8a1:
- d1ge8a1 first appeared (with stable ids) in SCOP 1.55
- d1ge8a1 appears in SCOPe 2.07
View in 3D
