Lineage for d1gb1__ (1gb1 -)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) 
Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species) Species Streptococcus sp., group G [TaxId:1306] [54361] (24 PDB entries) 
Domain d1gb1__: 1gb1 - [37830]
Details for d1gb1__
PDB Entry: 1gb1 (more details)
PDB Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
SCOP Domain Sequences for d1gb1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gb1__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
SCOP Domain Coordinates for d1gb1__:
Click to download the PDB-style file with coordinates for d1gb1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gb1__:
- d1gb1__ first appeared (with stable ids) in SCOP 1.55
- d1gb1__ appears in SCOP 1.69
- d1gb1__ is called d1gb1a_ in SCOP 1.73
- d1gb1__ appears in the current release, SCOPe 2.08, called d1gb1a_
View in 3D