Lineage for d1gado2 (1gad O:149-312)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (6 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (20 species) 
Species Escherichia coli [TaxId:562] [55350] (9 PDB entries)
Uniprot P06977
Domain d1gado2: 1gad O:149-312 [39865]
Other proteins in same PDB: d1gado1, d1gadp1
complexed with nad; mutant
Details for d1gado2
PDB Entry: 1gad (more details), 1.8 Å
PDB Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity
PDB Compounds: (O:) d-glyceraldehyde-3-phosphate dehydrogenaseSCOPe Domain Sequences for d1gado2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gado2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
cttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniipsst
gaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemk
gvlgyteddvvstdfngevctsvfdakagialndnfvklvswyd
SCOPe Domain Coordinates for d1gado2:
Click to download the PDB-style file with coordinates for d1gado2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gado2:
- d1gado2 first appeared (with stable ids) in SCOP 1.55
- d1gado2 appears in SCOPe 2.05
- d1gado2 appears in SCOPe 2.07
- d1gado2 appears in the current release, SCOPe 2.08
View in 3D
