SCOP 1.75: Domain d1g9mc2: 1g9m C:98-181

Lineage for d1g9mc2 (1g9m C:98-181)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.3: C2 set domains [49142] (8 proteins)
Protein CD4 C2-set domains [49149] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49150] (26 PDB entries)
Domain d1g9mc2: 1g9m C:98-181 [21660]
Other proteins in same PDB: d1g9mc1, d1g9mg_, d1g9mh1, d1g9mh2, d1g9ml1, d1g9ml2
domain 2
complexed with fuc, ioh, nag; mutant

Details for d1g9mc2

PDB Entry: 1g9m (more details), 2.2 Å

PDB Description: hiv-1 hxbc2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOP Domain Sequences for d1g9mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9mc2 b.1.1.3 (C:98-181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvlafqk

SCOP Domain Coordinates for d1g9mc2:

Click to download the PDB-style file with coordinates for d1g9mc2.
(The format of our PDB-style files is described here.)

Timeline for d1g9mc2: