![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.1: Outer membrane protein [56926] (3 proteins) automatically mapped to Pfam PF13505 |
![]() | Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56928] (5 PDB entries) |
![]() | Domain d1g90a_: 1g90 A: [60388] |
PDB Entry: 1g90 (more details)
SCOPe Domain Sequences for d1g90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g90a_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]} apkdntwytgaklgfsqyhdtgfinnngpthenqlgagafggyqvnpyvgfemgydflgr mpykgsvengaykaqgvqltaklgypitddldiytrlggmvfradtksnvygknhdtgvs pvfaggveyaitpeiatrleyqftnnigdahtigtrpdngmlslgvsyrfgqgeaa
Timeline for d1g90a_: