Lineage for d1g8qa_ (1g8q A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.135: Tetraspanin [48651] (1 superfamily)
5 helices: irregular disulfide-linked array; form homodimerSuperfamily a.135.1: Tetraspanin [48652] (1 family) 
Family a.135.1.1: Tetraspanin [48653] (2 proteins) 
Protein CD81 extracellular domain [48654] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48655] (2 PDB entries) 
Domain d1g8qa_: 1g8q A: [19621]
Details for d1g8qa_
PDB Entry: 1g8q (more details), 1.6 Å
PDB Description: crystal structure of human cd81 extracellular domain, a receptor for hepatitis c virus
PDB Compounds: (A:) cd81 antigen, extracellular domainSCOPe Domain Sequences for d1g8qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8qa_ a.135.1.1 (A:) CD81 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgkh
SCOPe Domain Coordinates for d1g8qa_:
Click to download the PDB-style file with coordinates for d1g8qa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g8qa_:
- d1g8qa_ first appeared (with stable ids) in SCOP 1.55
- d1g8qa_ appears in SCOPe 2.07
View in 3D
