Lineage for d1g8ma1 (1g8m A:4-200)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) 
contains a common phosphate-binding site
Family c.24.1.3: Inosicase [63971] (1 protein) Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [63973] (9 PDB entries)
Uniprot P31335
Domain d1g8ma1: 1g8m A:4-200 [60371]
Other proteins in same PDB: d1g8ma2, d1g8mb2
complexed with g, k
Details for d1g8ma1
PDB Entry: 1g8m (more details), 1.75 Å
PDB Description: crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
PDB Compounds: (A:) aicar transformylase-imp cyclohydrolaseSCOPe Domain Sequences for d1g8ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8ma1 c.24.1.3 (A:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]}
rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg
grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave
kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht
aqydaaisdyfrkeysk
SCOPe Domain Coordinates for d1g8ma1:
Click to download the PDB-style file with coordinates for d1g8ma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g8ma1:
- d1g8ma1 first appeared in SCOP 1.57
- d1g8ma1 appears in SCOPe 2.06
- d1g8ma1 appears in the current release, SCOPe 2.08
View in 3D
