Lineage for d1g7oa2 (1g7o A:1-75)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1369229Protein Glutaredoxin 2 [64060] (1 species)
    similar to class zeta enzymes
  7. 1369230Species Escherichia coli [TaxId:562] [64061] (1 PDB entry)
  8. 1369231Domain d1g7oa2: 1g7o A:1-75 [60333]
    Other proteins in same PDB: d1g7oa1

Details for d1g7oa2

PDB Entry: 1g7o (more details)

PDB Description: nmr solution structure of reduced e. coli glutaredoxin 2
PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d1g7oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}
mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgk

SCOPe Domain Coordinates for d1g7oa2:

Click to download the PDB-style file with coordinates for d1g7oa2.
(The format of our PDB-style files is described here.)

Timeline for d1g7oa2:

1369231
d1g7oa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1g7oa1