Lineage for d1g7oa1 (1g7o A:76-215)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1271089Protein Glutaredoxin 2 [63557] (1 species)
    similar to class zeta enzymes
  7. 1271090Species Escherichia coli [TaxId:562] [63558] (1 PDB entry)
  8. 1271091Domain d1g7oa1: 1g7o A:76-215 [60332]
    Other proteins in same PDB: d1g7oa2

Details for d1g7oa1

PDB Entry: 1g7o (more details)

PDB Description: nmr solution structure of reduced e. coli glutaredoxin 2
PDB Compounds: (A:) glutaredoxin 2

SCOPe Domain Sequences for d1g7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}
plltgkrspaieewlrkvngyanklllprfaksafdefstpaarkyfvdkkeasagnfad
llahsdgliknisddlraldklivkpnavngelseddiqlfpllrnltlvaginwpsrva
dyrdnmakqtqinllssmai

SCOPe Domain Coordinates for d1g7oa1:

Click to download the PDB-style file with coordinates for d1g7oa1.
(The format of our PDB-style files is described here.)

Timeline for d1g7oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g7oa2