Lineage for d1g6xa_ (1g6x A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890511Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 890512Superfamily g.8.1: BPTI-like [57362] (3 families) (S)
  5. 890513Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 890551Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 890552Species Cow (Bos taurus) [TaxId:9913] [57365] (81 PDB entries)
  8. 890553Domain d1g6xa_: 1g6x A: [60320]
    Ultra high resolution structure; 0.86 Angstrom
    complexed with edo, so4; mutant

Details for d1g6xa_

PDB Entry: 1g6x (more details), 0.86 Å

PDB Description: ultra high resolution structure of bovine pancreatic trypsin inhibitor (bpti) mutant with altered binding loop sequence
PDB Compounds: (A:) pancreatic trypsin inhibitor

SCOP Domain Sequences for d1g6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6xa_ g.8.1.1 (A:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppyagacrariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d1g6xa_:

Click to download the PDB-style file with coordinates for d1g6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1g6xa_: