Lineage for d1g6na2 (1g6n A:7-137)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559475Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1559481Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1559482Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)
  7. 1559483Species Escherichia coli [TaxId:562] [51212] (30 PDB entries)
  8. 1559496Domain d1g6na2: 1g6n A:7-137 [28139]
    Other proteins in same PDB: d1g6na1, d1g6nb1
    complexed with cmp

Details for d1g6na2

PDB Entry: 1g6n (more details), 2.1 Å

PDB Description: 2.1 angstrom structure of cap-camp
PDB Compounds: (A:) catabolite gene activator protein

SCOPe Domain Sequences for d1g6na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6na2 b.82.3.2 (A:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl

SCOPe Domain Coordinates for d1g6na2:

Click to download the PDB-style file with coordinates for d1g6na2.
(The format of our PDB-style files is described here.)

Timeline for d1g6na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g6na1