Lineage for d1g6na2 (1g6n A:7-137)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) Species Escherichia coli [TaxId:562] [51212] (28 PDB entries) 
Domain d1g6na2: 1g6n A:7-137 [28139]
Other proteins in same PDB: d1g6na1, d1g6nb1
complexed with cmp
Details for d1g6na2
PDB Entry: 1g6n (more details), 2.1 Å
PDB Description: 2.1 angstrom structure of cap-camp
PDB Compounds: (A:) catabolite gene activator proteinSCOPe Domain Sequences for d1g6na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6na2 b.82.3.2 (A:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl
SCOPe Domain Coordinates for d1g6na2:
Click to download the PDB-style file with coordinates for d1g6na2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g6na2:
- d1g6na2 first appeared (with stable ids) in SCOP 1.55
- d1g6na2 appears in SCOPe 2.02
- d1g6na2 appears in SCOPe 2.04
- d1g6na2 appears in the current release, SCOPe 2.08
View in 3D
