Lineage for d1g65g_ (1g65 G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2595033Domain d1g65g_: 1g65 G: [41966]
    Other proteins in same PDB: d1g651_, d1g652_, d1g65h_, d1g65i_, d1g65j_, d1g65k_, d1g65l_, d1g65m_, d1g65n_, d1g65v_, d1g65w_, d1g65x_, d1g65y_, d1g65z_
    different sequences
    complexed with mg

Details for d1g65g_

PDB Entry: 1g65 (more details), 2.25 Å

PDB Description: Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity of alpha,beta-epoxyketone proteasome inhibitors
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d1g65g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g65g_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d1g65g_:

Click to download the PDB-style file with coordinates for d1g65g_.
(The format of our PDB-style files is described here.)

Timeline for d1g65g_: