Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry) |
Domain d1g5ua_: 1g5u A: [40893] complexed with na |
PDB Entry: 1g5u (more details), 3.1 Å
SCOPe Domain Sequences for d1g5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ua_ d.110.1.1 (A:) Profilin (actin-binding protein) {Rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]} swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver lgdylldqgl
Timeline for d1g5ua_: