Lineage for d1g5aa1 (1g5a A:555-628)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Amylosucrase [69328] (1 species) Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries) 
Domain d1g5aa1: 1g5a A:555-628 [65152]
Other proteins in same PDB: d1g5aa2
complexed with epe, na, trs
Details for d1g5aa1
PDB Entry: 1g5a (more details), 1.4 Å
PDB Description: amylosucrase from neisseria polysaccharea
PDB Compounds: (A:) amylosucraseSCOPe Domain Sequences for d1g5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5aa1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia
SCOPe Domain Coordinates for d1g5aa1:
Click to download the PDB-style file with coordinates for d1g5aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g5aa1:
- d1g5aa1 first appeared in SCOP 1.59
- d1g5aa1 appears in SCOPe 2.05
- d1g5aa1 appears in SCOPe 2.07
- d1g5aa1 appears in the current release, SCOPe 2.08
View in 3D
