Lineage for d1g3jc_ (1g3j C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 646821Superfamily a.118.1: ARM repeat [48371] (22 families) (S)
  5. 646822Family a.118.1.1: Armadillo repeat [48372] (6 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 646823Protein beta-Catenin [48373] (2 species)
  7. 646824Species Human (Homo sapiens) [TaxId:9606] [48375] (9 PDB entries)
  8. 646829Domain d1g3jc_: 1g3j C: [19115]
    Other proteins in same PDB: d1g3jb_, d1g3jd_
    complex with xtcf3-cbd

Details for d1g3jc_

PDB Entry: 1g3j (more details), 2.1 Å

PDB Description: crystal structure of the xtcf3-cbd/beta-catenin armadillo repeat complex
PDB Compounds: (C:) beta-catenin armadillo repeat region

SCOP Domain Sequences for d1g3jc_:

Sequence, based on SEQRES records: (download)

>d1g3jc_ a.118.1.1 (C:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
hhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlagglqkm
vallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllwttsr
vlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegmegll
gtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdredite
paicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnlalcpa
nhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvrmeeivegctgalhilar
dvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegataplte
llhsrnegvatyaaavlfrmse

Sequence, based on observed residues (ATOM records): (download)

>d1g3jc_ a.118.1.1 (C:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}
hhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqegakmavrlagglqkm
vallnktnvkflaittdclqilaygnqeskliilasggpqalvnimrtytyekllwttsr
vlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnlsdaatkqegmegll
gtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvrtvlragdredite
paicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplikatvglirnlalcpa
nhaplreqgaiprlvqllvrahqdtqrrtsmgqqfvegvrmeeivegctgalhilardvh
nrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegatapltellh
srnegvatyaaavlfrmse

SCOP Domain Coordinates for d1g3jc_:

Click to download the PDB-style file with coordinates for d1g3jc_.
(The format of our PDB-style files is described here.)

Timeline for d1g3jc_: