Lineage for d1g3ga_ (1g3g A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663035Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 663036Superfamily b.26.1: SMAD/FHA domain [49879] (4 families) (S)
    has a few short helices inserted in loops
  5. 663070Family b.26.1.2: FHA domain [49885] (11 proteins)
  6. 663098Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 663099Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (17 PDB entries)
  8. 663116Domain d1g3ga_: 1g3g A: [23918]
    mutant

Details for d1g3ga_

PDB Entry: 1g3g (more details)

PDB Description: nmr structure of the fha1 domain of yeast rad53
PDB Compounds: (A:) protien kinase spk1

SCOP Domain Sequences for d1g3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
genitqptqqstqatqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekr
sikkvwtfgrnpacdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkvekns
nqllsqgdeitvgvgvesdilslvifindkfkqcleqnkvdrir

SCOP Domain Coordinates for d1g3ga_:

Click to download the PDB-style file with coordinates for d1g3ga_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ga_: