Lineage for d1g24a_ (1g24 A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.166: ADP-ribosylation [56398] (1 superfamily)
unusual foldSuperfamily d.166.1: ADP-ribosylation [56399] (7 families) 
Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins) Protein Exoenzyme c3 [56414] (3 species) 
Species Clostridium botulinum [TaxId:1491] [56415] (8 PDB entries)
Uniprot P15879 41-251
Domain d1g24a_: 1g24 A: [42270]
Details for d1g24a_
PDB Entry: 1g24 (more details), 1.7 Å
PDB Description: the crystal structure of exoenzyme c3 from clostridium botulinum
PDB Compounds: (A:) exoenzyme c3SCOP Domain Sequences for d1g24a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g24a_ d.166.1.1 (A:) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
styhiddmrlssdgkqiiitatmmgtainpk
SCOP Domain Coordinates for d1g24a_:
Click to download the PDB-style file with coordinates for d1g24a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g24a_:
- d1g24a_ first appeared (with stable ids) in SCOP 1.55
- d1g24a_ appears in SCOP 1.73
- d1g24a_ appears in SCOPe 2.01
- d1g24a_ appears in the current release, SCOPe 2.08
View in 3D
